Human EP300/P300 Protein, Made in Sf21 Insect Cell, with His Tag

Human EP300/P300 Protein, Made in Sf21 Insect Cell, with His Tag

SKU Description Size Price Shipping  
OP20041 Human EP300/P300 Protein, Made in Sf21 Insect Cell, with His Tag 4µg $409 Immediate Add To Shopping Cart
OP20042 Human EP300/P300 Protein, Made in Sf21 Insect Cell, with His Tag 10µg $818 Immediate Add To Shopping Cart
Other VersionsSame Protein [AA1135-2414] version. Same Protein CH1[AA302-531] version.
Biotin-labeled and heavy-labeled (C13 and N15) versions of this protein are also available. Please contact us for more information.
Datasheet
DescriptionHuman p300 and CBP (CREB binding protein) are highly related transcriptional coactivators. Both proteins have been identified through protein interaction assays . In addition to interacting with a variety of cellular factors and onco-proteins, loss of the wild type CBP alleles in isolated tumors suggests that CBP/p300 might serve as tumor suppressors . The ability of p300 to acetylate many transcription factors, including p53, E2F, TFIIE, and TFIIF etc. demonstrates a novel mechanism of targeted p300 regulation of gene expression.
Gene ID2033
Gene NameEP300
AliasKAT3B, RSTS2
Host SpeciesHuman
Production HostSf21 Insect Cell
TagsHis Tag
Purity> 95% as determined by SDS-PAGE
Bio Activity1 unit equals 1 nanogram of purified protein. 1-5 units are sufficient for a gel mobility shift assay in a 20µl reaction; 50-100 units are sufficient for a reconstituted transcription assay and 100-200 units are sufficient for a protein-protein interaction assay or an acetylation assay.
EndotoxinNot Tested
Formulation20 mM Tris-Cl (pH 7.9) 20% Glycerol, 100 mM KCl, 1 mM DTT and 0.2 mM EDTA
Concentration500 µg/ml
ReconsitutionAlready in liquid form.
Storage-80 °C
ShippingDry Ice
Background
GenBank Accession #: NM_001429
Amino Acid Sequence:
ENVVEPGPPS AKRPKLSSPA LSASASDGTD FGSLFDLEHD LPDELINSTE LGLTNGGDIN QLQTSLGMVQ DAASKHKQLS ELLRSGSSPN LNMGVGGPGQ VMASQAQQSS PGLGLINSMV KSPMTQAGLT SPNMGMGTSG PNQGPTQSTG MMNSPVNQPA MGMNTGMNAG MNPGMLAAGN GQGIMPNQVM NGSIGAGRGR QNMQYPNPGM GSAGNLLTEP LQQGSPQMGG QTGLRGPQPL KMGMMNNPNP YGSPYTQNPG QQIGASGLGL QIQTKTVLSN NLSPFAMDKK AVPGGGMPNM GQQPAPQVQQ PGLVTPVAQG MGSGAHTADP EKRKLIQQQL VLLLHAHKCQ RREQANGEVR QCNLPHCRTM KNVLNHMTHC QSGKSCQVAH CASSRQIISH WKNCTRHDCP VCLPLKNAGD KRNQQPILTG APVGLGNPSS LGVGQQSAPN LSTVSQIDPS SIERAYAALG LPYQVNQMPT QPQVQAKNQQ NQQPGQSPQG MRPMSNMSAS PMGVNGGVGV QTPSLLSDSM LHSAINSQNP MMSENASVPS LGPMPTAAQP STTGIRKQWH EDITQDLRNH LVHKLVQAIF PTPDPAALKD RRMENLVAYA RKVEGDMYES ANNRAEYYHL LAEKIYKIQK ELEEKRRTRL QKQNMLPNAA GMVPVSMNPG PNMGQPQPGM TSNGPLPDPS MIRGSVPNQM MPRITPQSGL NQFGQMSMAQ PPIVPRQTPP LQHHGQLAQP GALNPPMGYG PRMQQPSNQG QFLPQTQFPS QGMNVTNIPL APSSGQAPVS QAQMSSSSCP VNSPIMPPGS QGSHIHCPQL PQPALHQNSP SPVPSRTPTP HHTPPSIGAQ QPPATTIPAP VPTPPAMPPG PQSQALHPPP RQTPTPPTTQ LPQQVQPSLP AAPSADQPQQ QPRSQQSTAA SVPTPTAPLL PPQPATPLSQ PAVSIEGQVS NPPSTSSTEV NSQAIAEKQP SQEVKMEAKM EVDQPEPADT QPEDISESKV EDCKMESTET EERSTELKTE IKEEEDQPST SATQSSPAPG QSKKKIFKPE ELRQALMPTL EALYRQDPES LPFRQPVDPQ LLGIPDYFDI VKSPMDLSTI KRKLDTGQYQ EPWQYVDDIW LMFNNAWLYN RKTSRVYKYC SKLSEVFEQE IDPVMQSLGY CCGRKLEFSP QTLCCYGKQL CTIPRDATYY SYQNRYHFCE KCFNEIQGES VSLGDDPSQP QTTINKEQFS KRKNDTLDPELFVECTECGR KMHQICVLHH EIIWPAGFVC DGCLKKSART RKENKFSAKR LPSTRLGTFL ENRVNDFLRR QNHPESGEVT VRVVHASDKT VEVKPGMKAR FVDSGEMAES FPYRTKALFA FEEIDGVDLC FFGMHVQEYG SDCPPPNQRR VYISYLDSVH FFRPKCLRTA VYHEILIGYL EYVKKLGYTT GHIWACPPSE GDDYIFHCHP PDQKIPKPKR LQEWYKKMLD KAVSERIVHD YKDIFKQATE DRLTSAKELP YFEGDFWPNV LEESIKELEQ EEEERKREEN TSNESTDVTK GDSKNAKKKNNKKTSKNKSS LSRGNKKKPG MPNVSNDLSQ KLYATMEKHK EVFFVIRLIA GPAANSLPPI VDPDPLIPCD LMDGRDAFLT LARDKHLEFS SLRRAQWSTMC MLVELHTQS QDRFVYTCNE CKHHVETRWH CTVCEDYDLC ITCYNTKNHD HKMEKLGLGL DDESNNQQAA ATQSPGDSRR LSIQRCIQSL VHACQCRNAN CSLPSCQKMK RVVQHTKGCK RKTNGGCPIC KQLIALCCYH AKHCQENKCP VPFCLNIKQK LRQQQLQHRL QQAQMLRRRM ASMQRTGVVG QQQGLPSPTP ATPTTPTGQQ PTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Protein Image
SDS-PAGE alysis of recombint EP300