Mouse anti-Human CCL26 Monoclonal Antibody (Clone K29045_17D5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1779-100ul

  • Size

    100uL

  • Price

    $505

1
This antibody was raised against a protein with Unprot Accession # Q9Y258. It's core sequence is: TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
target CCL26
host Mouse
gene id 10344
reactivity Human
clonality Monoclonal
clone number K29045_17D5
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 25 ng of recombinant human CCL26 (Cat. PQ-193) was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K29045_17D5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CCL26 band was visualized using ECL Western Blotting Substrate. Result: K29045_17D5 can detect human CCL26 by Western blotting.


PRODUCT

  • SKU

    WZA1779-100ul

  • Size

    100uL

  • Price

    $505

1