Mouse anti-Human PIGR Monoclonal Antibody (Clone K94028_8F3)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1855-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P01833. It's core sequence is: RVSIRSYRTDISMSDFENSREFGANDNMGASSITQETSLGGKEEFVATTESTTETKEPKKAKRSSKEEAE
target PIGR
host Mouse
gene id 5284
reactivity Human
clonality Monoclonal
clone number K94028_8F3
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of colon tissue by PIGR antibody (K94028_8F3). IHC-P was performed using sections of the formalin-fixed paraffin-embedded colon tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K94028_8F3 with colon lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. PIGR (K94028_8F3) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: Colon lysate Lane 2: PIGR immunoprecipitated from colon lysate by K94028_8F3 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K94028_8F3 can immunoprecipitate PIGR.

Western Blot: 15 ug of colon lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K94028_8F3 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. PIGR band was visualized using ECL Western Blotting Substrate. Result: K94028_8F3 can detect PIGR by Western blotting.


PRODUCT

  • SKU

    WZA1855-100ul

  • Size

    100uL

  • Price

    $540

1