Mouse anti-Human SCGB3A2 Monoclonal Antibody (Clone K49035_3H11)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1902-100ul

  • Size

    100uL

  • Price

    $480

1
This antibody was raised against a protein with Unprot Accession # Q96PL1. It's core sequence is: FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
target SCGB3A2
host Mouse
gene id 117156
reactivity Human, Mouse
clonality Monoclonal
clone number K49035_3H11
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 15 ug of mouse lung tissue lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K49035_3H11 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. SCGB3A2 band was visualized using ECL Western Blotting Substrate. Result: K49035_3H11 can detect SCGB3A2 by Western blotting.


PRODUCT

  • SKU

    WZA1902-100ul

  • Size

    100uL

  • Price

    $480

1