Mouse anti-Human GAL Monoclonal Antibody (Clone K24019_11A9)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1905-100ul

  • Size

    100uL

  • Price

    $480

1
This antibody was raised against a protein with Unprot Accession # P22466. It's core sequence is: YLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI
target GAL
host Mouse
gene id 51083
reactivity Human
clonality Monoclonal
clone number K24019_11A9
iso type IgG2a
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 25 ng of recombinant human GAL (Cat. PP-223) was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K24019_11A9 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. GAL band was visualized using ECL Western Blotting Substrate. Result: K24019_11A9 can detect human GAL by Western blotting.


PRODUCT

  • SKU

    WZA1905-100ul

  • Size

    100uL

  • Price

    $480

1