Mouse anti-Human SULT2B1 Monoclonal Antibody (Clone K06341_18E7)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2080-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # O00204. It's core sequence is: EAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETP
target SULT2B1
host Mouse
gene id 6820
reactivity Human
clonality Monoclonal
clone number K06341_18E7
iso type IgG1
conjugate Unconjugated
applications IP
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K06341_18E7 with HT-29 lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. SULT2B1 (K06341_3C4) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: HT-29 lysate Lane 2: SULT2B1 immunoprecipitated from HT-29 lysate by K06341_18E7 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K06341_18E7 can immunoprecipitate SULT2B1.


PRODUCT

  • SKU

    WZA2080-100ul

  • Size

    100uL

  • Price

    $540

1