Mouse anti-Human PRKCD Monoclonal Antibody (Clone K06341_14D5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2098-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q05655. It's core sequence is: KCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEG
target PRKCD
host Mouse
gene id 5580
reactivity Human
clonality Monoclonal
clone number K06341_14D5
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of fallopian tube tissue by PRKCD antibody (K06341_14D5). IHC-P was performed using sections of the formalin-fixed paraffin-embedded fallopian tube tissue.

Western Blot: Various protein samples were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K06341_14D5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. PRKCD band was visualized using ECL Western Blotting Substrate. Lane 1: 15 ug of HeLa lysate Lane 2: 15 ug of SH-SY5Y lysate Lane 3: 15 ug of A-431 lysate Lane 4: 15 ug of HT-29 lysate Lane 5: 15 ug of Jurkat lysate Lane 6: 15 ug of K-562 lysate Result: K06341_14D5 can detect PRKCD by Western blotting.


PRODUCT

  • SKU

    WZA2098-100ul

  • Size

    100uL

  • Price

    $540

1