Mouse anti-Human KPNA1 Monoclonal Antibody (Clone K94035_3A10)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2171-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P52294. It's core sequence is: LKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEM
target KPNA1
host Mouse
gene id 3836
reactivity Human, Mouse
clonality Monoclonal
clone number K94035_3A10
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of testis tissue by KPNA1 antibody (K94035_3A10). IHC-P was performed using sections of the formalin-fixed paraffin-embedded testis tissue.

Western Blot: 15 ug of U-251MG lysate and 15 ug of mouse brain tissue lysate were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K94035_3A10 at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. KPNA1 band was visualized using ECL Western Blotting Substrate. Lane 1: 15 ug of U-251MG lysate Lane 2: 15 ug of mouse brain tissue lysate Result: K94035_3A10 can detect KPNA1 by Western blotting.


PRODUCT

  • SKU

    WZA2171-100ul

  • Size

    100uL

  • Price

    $540

1