Mouse anti-Human CXCL17 Monoclonal Antibody (Clone K52038_2E4)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2336-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q6UXB2. It's core sequence is: GHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQC
target CXCL17
host Mouse
gene id 284340
reactivity Human
clonality Monoclonal
clone number K52038_2E4
iso type IgG2b
conjugate Unconjugated
applications IHC, ICC, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K52038_19B9 at 3 ug/mL as the capture antibody. Recommbinant CXCL17 Protein (Cat. PP-1553) was used as the antigen. Peroxidase conjugated CXCL17 Antibody (K52038_2E4) was used as the detection antibody. Result: K52038_2E4 and K52038_19B9 can be used as a matched antibody pair to detect and quantify the concentration of CXCL17 .

Immunohistochemistry: IHC-P analysis of stomach tissue by CXCL17 antibody (K52038_2E4). IHC-P was performed using sections of the formalin-fixed paraffin-embedded stomach tissue.


PRODUCT

  • SKU

    WZA2336-100ul

  • Size

    100uL

  • Price

    $540

1