Mouse anti-Human PFKM Monoclonal Antibody (Clone K29051_11A4)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2414-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P08237. It's core sequence is: SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQ
target PFKM
host Mouse
gene id 5213
reactivity Human
clonality Monoclonal
clone number K29051_11A4
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of skeletal muscle tissue by PFKM antibody (K29051_11A4). IHC-P was performed using sections of the formalin-fixed paraffin-embedded skeletal muscle tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K29051_11A4 with SH-SY5Y lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. PFKM (OC-050) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: SH-SY5Y lysate Lane 2: PFKM immunoprecipitated from SH-SY5Y lysate by K29051_11A4 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K29051_11A4 can immunoprecipitate PFKM.


PRODUCT

  • SKU

    WZA2414-100ul

  • Size

    100uL

  • Price

    $540

1