Mouse anti-Human NDUFB8 Monoclonal Antibody (Clone K9N014_11C6)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2796-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # O95169. It's core sequence is: YPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLD
target NDUFB8
host Mouse
gene id 4714
reactivity Human, Rat, Mouse
clonality Monoclonal
clone number K9N014_11C6
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200-1:250, WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of heart muscle tissue by NDUFB8 antibody (K9N014_11C6). IHC-P was performed using sections of the formalin-fixed paraffin-embedded heart muscle tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K9N014_11C6 with Hep G2 lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. NDUFB8 (K9N014_11C6) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG (Fc specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: Hep G2 lysate Lane 2: NDUFB8 immunoprecipitated from Hep G2 lysate by K9N014_11C6 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K9N014_11C6 can immunoprecipitate NDUFB8.

Western Blot: Various protein samples were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K9N014_11C6 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG (Fc specific) was used as the secondary antibody. NDUFB8 band was visualized using ECL Western Blotting Substrate. Lane 1: 15 ug of HeLa lysate Lane 2: 15 ug of Hep G2 lysate Lane 3: 15 ug of THP-1 lysate Lane 4: 15 ug of U-251MG lysate Lane 5: 15 ug of A549 lysate Lane 6: 15 ug of rat brain tissue lysate Lane 7: 15 ug of mouse brain tissue lysate Lane 8: 15 ug of mouse heart tissue lysate Lane 9: 15 ug of HEK-293 lysate Lane 10: 15 ug of Caco-2 lysate Lane 11: 15 ug of HL-60 lysate Result: K9N014_11C6 can detect NDUFB8 by Western blotting.


PRODUCT

  • SKU

    WZA2796-100ul

  • Size

    100uL

  • Price

    $540

1