Mouse anti-Human PRR4 Monoclonal Antibody (Clone K8U015_17B8)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3162-100ul

  • Size

    100uL

  • Price

    $480

1
This antibody was raised against a protein with Unprot Accession # Q16378. It's core sequence is: RPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPRRGHRQLSLPRFPSV
target PRR4
host Mouse
gene id 11272
reactivity Human, Mouse
clonality Monoclonal
clone number K8U015_17B8
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 15 ug of Caco-2 lysate and 15 ug of NIH/3T3 lysate were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K8U015_17B8 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. PRR4 band was visualized using ECL Western Blotting Substrate. Lane 1: 15 ug of Caco-2 lysate Lane 2: 15 ug of NIH/3T3 lysate Result: K8U015_17B8 can detect PRR4 by Western blotting.


PRODUCT

  • SKU

    WZA3162-100ul

  • Size

    100uL

  • Price

    $480

1