Mouse anti-Human CTSF Monoclonal Antibody (Clone K52075_1D5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3173-100ul

  • Size

    100uL

  • Price

    $480

1
This antibody was raised against a protein with Unprot Accession # Q9UBX1. It's core sequence is: NQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKL
target CTSF
host Mouse
gene id 8722
reactivity Human, Mouse
clonality Monoclonal
clone number K52075_1D5
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 15 ug of mouse heart tissue lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K52075_1D5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. CTSF band was visualized using ECL Western Blotting Substrate. Result: K52075_1D5 can detect CTSF by Western blotting.


PRODUCT

  • SKU

    WZA3173-100ul

  • Size

    100uL

  • Price

    $480

1