Mouse anti-Human TMEM25 Monoclonal Antibody (Clone K8U015_1G5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3367-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q86YD3. It's core sequence is: CRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPEL
target TMEM25
host Mouse
gene id 84866
reactivity Human, Mouse
clonality Monoclonal
clone number K8U015_1G5
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200-1:250, WB 1:2000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of brain tissue by TMEM25 antibody (K8U015_1G5). IHC-P was performed using sections of the formalin-fixed paraffin-embedded brain tissue.

Western Blot: 15 ug of U-251MG lysate and 15 ug of NIH/3T3 lysate were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K8U015_1G5 at 0.5 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. TMEM25 band was visualized using ECL Western Blotting Substrate. Lane 1: 15 ug of U-251MG lysate Lane 2: 15 ug of NIH/3T3 lysate Result: K8U015_1G5 can detect TMEM25 by Western blotting.


PRODUCT

  • SKU

    WZA3367-100ul

  • Size

    100uL

  • Price

    $540

1