Mouse anti-Human PLXDC2 Monoclonal Antibody (Clone K2K007_5B2)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3557-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q6UX71. It's core sequence is: ENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKGG
target PLXDC2
host Mouse
gene id 84898
reactivity Human
clonality Monoclonal
clone number K2K007_5B2
iso type IgG2b
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:500-1:1000, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of breast cancer tissue by PLXDC2 antibody (K2K007_5B2). IHC-P was performed using sections of the formalin-fixed paraffin-embedded breast cancer tissue.

Western Blot: 15 ug of brain tissue lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K2K007_5B2 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. PLXDC2 band was visualized using ECL Western Blotting Substrate. Result: K2K007_5B2 can detect PLXDC2 by Western blotting.


PRODUCT

  • SKU

    WZA3557-100ul

  • Size

    100uL

  • Price

    $540

1