Mouse anti-Human CPA2 Monoclonal Antibody (Clone K24056_8E4)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3705-100ul

  • Size

    100uL

  • Price

    $480

1
This antibody was raised against a protein with Unprot Accession # P48052. It's core sequence is: TKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVK
target CPA2
host Mouse
gene id 1358
reactivity Human, Mouse
clonality Monoclonal
clone number K24056_8E4
iso type IgG2b
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 15 ug of mouse pancreas tissue lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K24056_8E4 at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. CPA2 band was visualized using ECL Western Blotting Substrate. Result: K24056_8E4 can detect CPA2 by Western blotting.


PRODUCT

  • SKU

    WZA3705-100ul

  • Size

    100uL

  • Price

    $480

1