Mouse anti-Human SKP2 Monoclonal Antibody (Clone K2K010_4G2)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3857-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q13309. It's core sequence is: DLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRE
target SKP2
host Mouse
gene id 6502
reactivity Human
clonality Monoclonal
clone number K2K010_4G2
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100-1:200, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of breast cancer tissue by SKP2 antibody (K2K010_4G2). IHC-P was performed using sections of the formalin-fixed paraffin-embeddded breast cancer tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K2K010_4G2 with Caco-2 lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. SKP2 (K2K006_5D8) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: Caco-2 lysate Lane 2: SKP2 immunoprecipitated from Caco-2 lysate by K2K010_4G2 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K2K010_4G2 can immunoprecipitate SKP2.


PRODUCT

  • SKU

    WZA3857-100ul

  • Size

    100uL

  • Price

    $540

1