Mouse anti-Human SMPD3 Monoclonal Antibody (Clone K40093_4H3)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3919-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q9NY59. It's core sequence is: NHNQQDGDSGSLGSPSASRESLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVSAFFPANLDFL
target SMPD3
host Mouse
gene id 55512
reactivity Human
clonality Monoclonal
clone number K40093_4H3
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:250-1:500, WB 1:3000-1:4000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of small intestine tissue by SMPD3 antibody (K40093_4H3). IHC-P was performed using sections of the formalin-fixed paraffin-embedded small intestine tissue.

Western Blot: 15 ug of HCT116 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K40093_4H3 at 0.25 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. SMPD3 band was visualized using ECL Western Blotting Substrate. Result: K40093_4H3 can detect SMPD3 by Western blotting.


PRODUCT

  • SKU

    WZA3919-100ul

  • Size

    100uL

  • Price

    $540

1