Mouse anti-Human XIAP Monoclonal Antibody (Clone K94008_8E3)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4146-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P98170. It's core sequence is: CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS
target XIAP
host Mouse
gene id 331
reactivity Human
clonality Monoclonal
clone number K94008_8E3
iso type IgG2a
conjugate Unconjugated
applications IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug K94008_8E3 with HeLa lysate containing 200 ug total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. XIAP (K94008_10B10) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: HeLa lysate Lane 2: XIAP immunoprecipitated from HeLa lysate by K94008_8E3 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K94008_8E3 can immunoprecipitate XIAP.

Western Blot: Various protein samples were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K94008_8E3 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. XIAP band was visualized using ECL Substrate. Lane 1: 15 ug of MCF7 lysate Lane 2: 15 ug of HeLa lysate Lane 3: 15 ug of HT-29 lysate Result: K94008_8E3 can detect XIAP by Western blotting.


PRODUCT

  • SKU

    WZA4146-100ul

  • Size

    100uL

  • Price

    $650

1