Mouse anti-Human AREG Monoclonal Antibody (Clone K1E006_10A9)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4158-100ul

  • Size

    100uL

  • Price

    $505

1
This antibody was raised against a protein with Unprot Accession # P15514. It's core sequence is: PQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
target AREG
host Mouse
gene id 374
reactivity Human
clonality Monoclonal
clone number K1E006_10A9
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 15 ug of MCF-7 lysate and 15 ug of HT-29 lysate were run on 6-18% SDS-PAGE under reducing conditions and blotted onto PVDF membrane. K1E006_10A9 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. AREG band was visualized using ECL Substrate. Lane 1: 15 ug of MCF-7 lysate Lane 2: 15 ug of HT-29 lysate Result: K1E006_10A9 can detect AREG by Western blotting.


PRODUCT

  • SKU

    WZA4158-100ul

  • Size

    100uL

  • Price

    $505

1