Mouse anti-Human RELA Monoclonal Antibody (Clone K01_2S63)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4473-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q04206. It's core sequence is: QVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRH
target RELA
host Mouse
gene id 5970
reactivity Human, Mouse, Rat
clonality Monoclonal
clone number K01_2S63
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP, WB, IF
formulation Liquid in PBS containing 50% glycerol,0.5% BSA and 0.02% sodium azide,pH 7.3.
dilution IHC 1:50-1:100, WB 1:500-1:1000, IP 1:20, IF 1:50-1:200
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunofluorescence analysis of NF-KB p65 (3D2) in Hela using NF-KB p65 (3D2) antibody,and DAPI (blue).

Immunohistochemistry: Immunohistochemistry analysis of paraffin-embedded rat Brain Tissue using NF-KB p65 antibody.

Immunoprecipitation: Immunoprecipitation analysis of NF-KB p65 (3D2) in Hela lysates using NFkB p65 (3D2) antibody.

Western Blot: Western blot analysis of NF-KB p65 (3D2) in COS7,C6,T47D lysates using NF-KB p65 (3D2) antibody.

Western Blot: Western blot analysis of NF-KB p65 in T47D,3T3,COS7,C6 and Hela lysates using NF-KB p65 antibody.


PRODUCT

  • SKU

    WZA4473-100ul

  • Size

    100uL

  • Price

    $540

1