Mouse anti-Human PECAM1 Monoclonal Antibody (Clone K49019_11A5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4691-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P16284. It's core sequence is: KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES
target PECAM1
host Mouse
gene id 5175
reactivity Human, Rat
clonality Monoclonal
clone number K49019_11A5
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Western Blot: 15 ug of NIH/3T3 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K49019_11A5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. PECAM1 band was visualized using ECL Western Blotting Substrate. Result: K49019_11A5 can detect PECAM1 by Western blotting.

Western Blot: 15 ug of rat spleen tissue was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K49019_11A5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. PECAM1 band was visualized using ECL Western Blotting Substrate. Result: K49019_11A5 can detect PECAM1 by Western blotting.


PRODUCT

  • SKU

    WZA4691-100ul

  • Size

    100uL

  • Price

    $650

1