Mouse anti-Human CD9 Monoclonal Antibody (Clone K52008_2G12)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4694-100ul

  • Size

    100uL

  • Price

    $720

1
This antibody was raised against a protein with Unprot Accession # P21926. It's core sequence is: VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFD
target CD9
host Mouse
gene id 928
reactivity Human
clonality Monoclonal
clone number K52008_2G12
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of kidney tissue by CD9 antibody (K52008_2G12). IHC-P was performed using sections of the formalin-fixed paraffin-embedded kidney tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug K52008_2G12 with MCF7 lysate containing 200 ug total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. CD9 (K52008_18D11) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG (Fc specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: CD9 immunoprecipitated from MCF7 lysate by K52008_2G12 Lane 2: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K52008_2G12 can immunoprecipitate CD9.


PRODUCT

  • SKU

    WZA4694-100ul

  • Size

    100uL

  • Price

    $720

1