Mouse anti-Human FETUB Monoclonal Antibody (Clone K49014_4E12)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4791-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # Q9UGM5. It's core sequence is: VNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPME
target FETUB
host Mouse
gene id 26998
reactivity Human
clonality Monoclonal
clone number K49014_4E12
iso type IgG2b
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of hepatocellular carcinoma tissue by FETUB antibody (K49014_4E12). IHC-P was performed using sections of the formalin-fixed paraffin-embedded hepatocellular carcinoma tissue.

Western Blot: 15 ug of kidney tissue lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K49014_4E12 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. FETUB band was visualized using ECL Western Blotting Substrate. Result: K49014_4E12 can detect FETUB by Western blotting.


PRODUCT

  • SKU

    WZA4791-100ul

  • Size

    100uL

  • Price

    $650

1