Mouse anti-Human F3 Monoclonal Antibody (Clone K06319_4H12)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA5075-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P13726. It's core sequence is: LTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVE
target F3
host Mouse
gene id 2152
reactivity Human
clonality Monoclonal
clone number K06319_4H12
iso type IgG2a
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100-1:200, WB 1:500-1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of kidney tissue by F3 antibody (K06319_4H12). IHC-P was performed using sections of the formalin-fixed paraffin-embedded kidney tissue.

Western Blot: 15 ug of A-431 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K06319_4H12 at 1.75 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. F3 band was visualized using ECL Western Blotting Substrate. Result: K06319_4H12 can detect F3 by Western blotting.


PRODUCT

  • SKU

    WZA5075-100ul

  • Size

    100uL

  • Price

    $650

1