Recombinant Mouse anti-Human WNT7A Monoclonal Antibody (Clone K8U018_3H2)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA8081-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # O00755. It's core sequence is: KYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCG
target WNT7A
host Mouse
gene id 7476
reactivity Human, Mouse
clonality Monoclonal
clone number K8U018_3H2
iso type IgG2a
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100-1:200, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of ductal breast cancer tissue by WNT7A antibody (K8U018_3H2). IHC-P was performed using sections of the formalin-fixed paraffin-embedded ductal breast cancer tissue.

Western Blot: 15 ug of mouse testis tissue lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K8U018_3H2 at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. WNT7A band was visualized using ECL Western Blotting Substrate. Result: K8U018_3H2 can detect WNT7A by Western blotting.


PRODUCT

  • SKU

    WZA8081-100ul

  • Size

    100uL

  • Price

    $540

1