Recombinant Mouse anti-Human ST3GAL1 Monoclonal Antibody (Clone K94059_11C7)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA8102-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q11201. It's core sequence is: NNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEAD
target ST3GAL1
host Mouse
gene id 6482
reactivity Human
clonality Monoclonal
clone number K94059_11C7
iso type IgG2a
conjugate Unconjugated
applications IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K94059_11C7 with PC-3 lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. ST3GAL1 (K94059_11C7) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: PC-3 lysate Lane 2: ST3GAL1 immunoprecipitated from PC-3 lysate by K94059_11C7 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K94059_11C7 can immunoprecipitate ST3GAL1.

Western Blot: 15 ug of PC-3 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K94059_11C7 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. ST3GAL1 band was visualized using ECL Western Blotting Substrate. Result: K94059_11C7 can detect ST3GAL1 by Western blotting.


PRODUCT

  • SKU

    WZA8102-100ul

  • Size

    100uL

  • Price

    $540

1