Mouse anti-Human DGKZ Monoclonal Antibody (Clone K49027_8F3)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1292-100ul

  • Size

    100uL

  • Price

    $795

1
This antibody was raised against a protein with Unprot Accession # Q13574-1. It's core sequence is: STGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQR
target DGKZ
host Mouse
reactivity Human, Mouse
clonality Monoclonal
clone number K49027_8F3
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of cerebellum tissue by anti-DGKZ antibody (K49027_8F3). IHC-P was performed using sections of the formalin-fixed paraffin-embedded cerebellum tissue.

Western Blot: 15 ug of mouse brain lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K49027_8F3 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. DGKZ band was visualized using ECL Western Blotting Substrate. Result: K49027_8F3 can detect DGKZ by Western blotting.


PRODUCT

  • SKU

    WZA1292-100ul

  • Size

    100uL

  • Price

    $795

1