Mouse anti-Human CAPG Monoclonal Antibody (Clone K52030_2E1)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1360-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P40121. It's core sequence is: RDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSS
target CAPG
host Mouse
gene id 822
reactivity Human
clonality Monoclonal
clone number K52030_2E1
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:500, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of lung tissue by CAPG antibody (K52030_2E1). IHC-P was performed using sections of the formalin-fixed paraffin-embedded lung tissue.

Western Blot: 15 ug of THP-1 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K52030_2E1 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CAPG band was visualized using ECL Western Blotting Substrate. Result: K52030_2E1 can detect CAPG by Western blotting.


PRODUCT

  • SKU

    WZA1360-100ul

  • Size

    100uL

  • Price

    $650

1