Mouse anti-Human CXCL12 Monoclonal Antibody (Clone K92033_2F2)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1910-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P48061. It's core sequence is: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
target CXCL12
host Mouse
gene id 6387
reactivity Human
clonality Monoclonal
clone number K92033_2F2
iso type IgG1
conjugate Unconjugated
applications WB, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K92033_2F2 at 3.0 ug/mL as the capture antibody. CXCL12 (Cat. PP-3056) was used as the antigen. Peroxidase conjugated mouse anti-human CXCL12 monoclonal antibody (K92033_9D8) was used as the detection antibody. Result: K92033_2F2 and K92033_9D8 can be used as a matched antibody pair to detect and quantify the concentration of CXCL12 .

Western Blot: 25 ng of recombinant human CXCL12 (Cat. PP-3056) was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K92033_2F2 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CXCL12 band was visualized using ECL Western Blotting Substrate. Result: K92033_2F2 can detect human CXCL12 by Western blotting.


PRODUCT

  • SKU

    WZA1910-100ul

  • Size

    100uL

  • Price

    $540

1