Mouse anti-Human TGFA Monoclonal Antibody (Clone K94022_18E9)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1971-100ul

  • Size

    100uL

  • Price

    $505

1
This antibody was raised against a protein with Unprot Accession # P01135. It's core sequence is: SADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
target TGFA
host Mouse
gene id 7039
reactivity Human
clonality Monoclonal
clone number K94022_18E9
iso type IgG2a
conjugate Unconjugated
applications WB, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K94027_2E8 at 3.0 ug/mL as the capture antibody. TGFA (Cat. PP-3331) was used as the antigen. Peroxidase conjugated mouse anti-human TGFA monoclonal antibody (K94022_18E9) was used as the detection antibody. Result: K94022_18E9 and K94027_2E8 can be used as a matched antibody pair to detect and quantify the concentration of TGFA .

Western Blot: 25 ng of recombinant human TGFA (Cat. PP-3331) was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K94022_18E9 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. TGFA band was visualized using ECL Western Blotting Substrate. Result: K94022_18E9 can detect TGFA by Western blotting.


PRODUCT

  • SKU

    WZA1971-100ul

  • Size

    100uL

  • Price

    $505

1