Mouse anti-Human MMP13 Monoclonal Antibody (Clone K1L001_20C12)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2911-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P45452. It's core sequence is: DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK
target MMP13
host Mouse
gene id 4322
reactivity Human
clonality Monoclonal
clone number K1L001_20C12
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200-1:250, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K1L001_5A11 at 3.0 ug/mL as the capture antibody. MMP13 (Cat. PP-295) was used as the antigen. Peroxidase conjugated mouse anti-human MMP13 monoclonal antibody (K1L001_20C12,K1L001_20C12) was used as the detection antibody. Result: K1L001_20C12,K1L001_20C12 and K1L001_5A11 can be used as a matched antibody pair to detect and quantify the concentration of MMP13 .

Immunohistochemistry: IHC-P analysis of breast tissue by MMP13 antibody (K1L001_20C12). IHC-P was performed using sections of the formalin-fixed paraffin-embedded breast tissue.


PRODUCT

  • SKU

    WZA2911-100ul

  • Size

    100uL

  • Price

    $540

1