Mouse anti-Human CXCL6 Monoclonal Antibody (Clone K29056_7D12)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3083-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P80162. It's core sequence is: GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
target CXCL6
host Mouse
gene id 6372
reactivity Human
clonality Monoclonal
clone number K29056_7D12
iso type IgG2b
conjugate Unconjugated
applications WB, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K29056_7D12 at 3.0 ug/mL as the capture antibody. CXCL6 (Cat. PQ-267) was used as the antigen. Peroxidase conjugated mouse anti-human CXCL6 monoclonal antibody (K29056_17G12) was used as the detection antibody. Result: K29056_7D12 and K29056_17G12 can be used as a matched antibody pair to detect and quantify the concentration of CXCL6 .

Western Blot: 25 ng of recombinant human CXCL6 (Cat. PQ-267) lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K29056_7D12 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CXCL6 band was visualized using ECL Western Blotting Substrate. Result: K29056_7D12 can detect CXCL6 by Western blotting.


PRODUCT

  • SKU

    WZA3083-100ul

  • Size

    100uL

  • Price

    $540

1