Mouse anti-Human AKT1S1 Monoclonal Antibody (Clone K16283_7E6)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3625-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # Q96B36. It's core sequence is: AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQ
target AKT1S1
host Mouse
gene id 84335
reactivity Human
clonality Monoclonal
clone number K16283_7E6
iso type IgG1
conjugate Unconjugated
applications ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K16283_7E6 at 3 ug/mL as the capture antibody. Recommbinant AKT1S1 Protein (Cat. PP-1208) was used as the antigen. 1 ug/mL biotin conjugated AKT1S1 Antibody (K16267_9C1) was used as the detection antibody. SA-HRP was then added to the system. Result: K16283_7E6 and K16267_9C1 can be used as a matched antibody pair to detect and quantify the concentration of AKT1S1 .


PRODUCT

  • SKU

    WZA3625-100ul

  • Size

    100uL

  • Price

    $540

1