Mouse anti-Human JUN Monoclonal Antibody (Clone K70016_15A1)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4189-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P05412. It's core sequence is: TVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQ
target JUN
host Mouse
gene id 3725
reactivity Human
clonality Monoclonal
clone number K70016_15A1
iso type IgG1
conjugate Unconjugated
applications IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug K70016_15A1 with HEK-293 lysate containing 200 ug total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. JUN (K70016_5B4) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: JUN immunoprecipitated from HEK-293 lysate by K70016_15A1 Lane 2: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K70016_15A1 can immunoprecipitate JUN.

Western Blot: 15 ug of HEK-293 lysate and 15 ug of NIH/3T3 lysate were run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K70016_15A1 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. JUN band was visualized using ECL Substrate. Lane 1: 15 ug of HEK-293 lysate Lane 2: 15 ug of NIH/3T3 lysate Result: K70016_15A1 can detect JUN by Western blotting.


PRODUCT

  • SKU

    WZA4189-100ul

  • Size

    100uL

  • Price

    $650

1