Mouse anti-Human JUN Monoclonal Antibody (Clone K70016_8D7)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4190-100ul

  • Size

    100uL

  • Price

    $580

1
This antibody was raised against a protein with Unprot Accession # P05412. It's core sequence is: TVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQ
target JUN
host Mouse
gene id 3725
reactivity Human
clonality Monoclonal
clone number K70016_8D7
iso type IgG2a
conjugate Unconjugated
applications IP
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug K70016_8D7 with HEK-293 lysate containing 200 ug total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. JUN (K70016_5B4) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: JUN immunoprecipitated from HEK-293 lysate by K70016_8D7 Lane 2: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K70016_8D7 can immunoprecipitate JUN.


PRODUCT

  • SKU

    WZA4190-100ul

  • Size

    100uL

  • Price

    $580

1