Mouse anti-Human CHEK1 Monoclonal Antibody (Clone K52027_2A4)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4985-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # O14757. It's core sequence is: KGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP
target CHEK1
host Mouse
gene id 1111
reactivity Human
clonality Monoclonal
clone number K52027_2A4
iso type IgG2a
conjugate Unconjugated
applications IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K52027_2A4 with MOLT-4 lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. Anti- CHEK1 (K52027_2A4) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: MOLT-4 lysate Lane 2: CHEK1 immunoprecipitated from MOLT-4 lysate by K52027_2A4 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K52027_2A4 can immunoprecipitate CHEK1.

Western Blot: 15 ug of MOLT-4 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K52027_2A4 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CHEK1 band was visualized using ECL Substrate. Result: K52027_2A4 can detect CHEK1 by Western blotting.


PRODUCT

  • SKU

    WZA4985-100ul

  • Size

    100uL

  • Price

    $650

1