Mouse anti-Human EGFR Monoclonal Antibody (Clone K49030_1H5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1278-100ul

  • Size

    100uL

  • Price

    $795

1
This antibody was raised against a protein with Unprot Accession # P00533. It's core sequence is: SDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNST
target EGFR
host Mouse
gene id 1956
reactivity Human
clonality Monoclonal
clone number K49030_1H5
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of placenta tissue by EGFR antibody (K49030_1H5). IHC-P was performed using sections of the formalin-fixed paraffin-embedded placenta tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K49030_1H5 with A-431 lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. EGFR (K49030_1G1) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: A-431 lysate Lane 2: EGFR immunoprecipitated from A-431 lysate by K49030_1H5 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K49030_1H5 can immunoprecipitate EGFR.

Western Blot: 15 ug of A-431 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K49030_1H5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. EGFR band was visualized using ECL Western Blotting Substrate. Result: K49030_1H5 can detect EGFR by Western blotting.


PRODUCT

  • SKU

    WZA1278-100ul

  • Size

    100uL

  • Price

    $795

1