Mouse anti-Human CD63 Monoclonal Antibody (Clone K06337_9C12)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1580-100ul

  • Size

    100uL

  • Price

    $720

1
This antibody was raised against a protein with Unprot Accession # P08962-1. It's core sequence is: VMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR
target CD63
host Mouse
reactivity Human
clonality Monoclonal
clone number K06337_9C12
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K8U003_12D9 at 3.0 ug/mL as the capture antibody. CD63 (Cat. P09869SA) was used as the antigen. Peroxidase conjugated mouse anti-human CD63 monoclonal antibody (K06337_9C12) was used as the detection antibody. Result: K06337_9C12 and K8U003_12D9 can be used as a matched antibody pair to detect and quantify the concentration of CD63 .

Immunohistochemistry: IHC-P analysis of colon tissue by CD63 antibody (K06337_9C12). IHC-P was performed using sections of the formalin-fixed paraffin-embedded colon tissue.

Immunohistochemistry: IHC-P analysis of melanoma tissue by CD63 antibody (K06337_9C12). IHC-P was performed using sections of the formalin-fixed paraffin-embedded melanoma tissue.


PRODUCT

  • SKU

    WZA1580-100ul

  • Size

    100uL

  • Price

    $720

1