Mouse anti-Human C3 Monoclonal Antibody (Clone K70031_7G2)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2477-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P01024. It's core sequence is: DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE
target C3
host Mouse
gene id 718
reactivity Human
clonality Monoclonal
clone number K70031_7G2
iso type IgG1
conjugate Unconjugated
applications IP, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IP 1:100, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K70031_1E5 at 3.0 ug/mL as the capture antibody. C3 (Cat. PP-055) was used as the antigen. Peroxidase conjugated mouse anti-human C3 monoclonal antibody (K70031_7G2) was used as the detection antibody. Result: K70031_7G2 and K70031_1E5 can be used as a matched antibody pair to detect and quantify the concentration of C3 .

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K70031_7G2 with human plasma containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. C3 (K70031_14F6) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: Human plasma Lane 2: C3 immunoprecipitated from human plasma by K70031_7G2 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K70031_7G2 can immunoprecipitate C3.


PRODUCT

  • SKU

    WZA2477-100ul

  • Size

    100uL

  • Price

    $540

1