Mouse anti-Human C3 Monoclonal Antibody (Clone K70031_14F6)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4846-100ul

  • Size

    100uL

  • Price

    $580

1
This antibody was raised against a protein with Unprot Accession # P01024. It's core sequence is: DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE
target C3
host Mouse
gene id 718
reactivity Human
clonality Monoclonal
clone number K70031_14F6
iso type IgG2a
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of testis tissue by C3 antibody (K70031_14F6). IHC-P was performed using sections of the formalin-fixed paraffin-embedded testis tissue.

Western Blot: 15 ug of human plasma was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K70031_14F6 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. C3 band was visualized using ECL Western Blotting Substrate. Result: K70031_14F6 can detect C3 by Western blotting.


PRODUCT

  • SKU

    WZA4846-100ul

  • Size

    100uL

  • Price

    $580

1