Mouse anti-Human GDNF Monoclonal Antibody (Clone K92005_2F3)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4737-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P39905. It's core sequence is: RNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLV
target GDNF
host Mouse
gene id 2668
reactivity Human
clonality Monoclonal
clone number K92005_2F3
iso type IgG2a
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:100, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of brain tissue by GDNF antibody (K92005_2F3). IHC-P was performed using sections of the formalin-fixed paraffin-embedded brain tissue.

Western Blot: 25 ng of recombinant human GDNF (Cat. P01924PC) was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K92005_2F3 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. GDNF band was visualized using ECL Substrate. Result: K92005_2F3 can detect human GDNF by Western blotting.


PRODUCT

  • SKU

    WZA4737-100ul

  • Size

    100uL

  • Price

    $650

1