Mouse anti-Human CD38 Monoclonal Antibody (Clone K94011_11B7)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA5023-100ul

  • Size

    100uL

  • Price

    $795

1
This antibody was raised against a protein with Unprot Accession # P28907. It's core sequence is: SRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN
target CD38
host Mouse
gene id 952
reactivity Human
clonality Monoclonal
clone number K94011_11B7
iso type IgG1
conjugate Unconjugated
applications IP, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, IP 1:100
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug of K94011_11B7 with Ramos lysate containing 200 ug of total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. CD38 (K94011_3G5) at 1 ug/mL was used as the primary antibody and peroxidase conjugated rabbit anti-mouse IgG (Light chain specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: Ramos lysate Lane 2: CD38 immunoprecipitated from Ramos lysate by K94011_11B7 Lane 3: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K94011_11B7 can immunoprecipitate CD38.

Western Blot: 15 ug of Ramos lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K94011_11B7 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CD38 band was visualized using ECL Substrate. Result: K94011_11B7 can detect CD38 by Western blotting.


PRODUCT

  • SKU

    WZA5023-100ul

  • Size

    100uL

  • Price

    $795

1