Mouse anti-Human CCL8 Monoclonal Antibody (Clone K52037_8B9)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2067-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P80075. It's core sequence is: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
target CCL8
host Mouse
gene id 6355
reactivity Human
clonality Monoclonal
clone number K52037_8B9
iso type IgG1
conjugate Unconjugated
applications WB, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K52037_8B9 at 3.0 ug/mL as the capture antibody. CCL8 (Cat. PP-3673) was used as the antigen. Peroxidase conjugated mouse anti-human CCL8 monoclonal antibody (K52037_16E3) was used as the detection antibody. Result: K52037_8B9 and K52037_16E3 can be used as a matched antibody pair to detect and quantify the concentration of CCL8 .

Western Blot: 25 ng of recombinant human CCL8 (Cat. PP-3673) was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K52037_8B9 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CCL8 band was visualized using ECL Western Blotting Substrate. Result: K52037_8B9 can detect CCL8 by Western blotting.


PRODUCT

  • SKU

    WZA2067-100ul

  • Size

    100uL

  • Price

    $540

1