Mouse anti-Human CCL8 Monoclonal Antibody (Clone K52037_11B4)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA2200-100ul

  • Size

    100uL

  • Price

    $540

1
This antibody was raised against a protein with Unprot Accession # P80075. It's core sequence is: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
target CCL8
host Mouse
gene id 6355
reactivity Human
clonality Monoclonal
clone number K52037_11B4
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K52037_11B4 at 3.0 ug/mL as the capture antibody. CCL8 (Cat. PP-3673) was used as the antigen. Peroxidase conjugated mouse anti-human CCL8 monoclonal antibody (K52037_16E3) was used as the detection antibody. Result: K52037_11B4 and K52037_16E3 can be used as a matched antibody pair to detect and quantify the concentration of CCL8 .

Immunohistochemistry: IHC-P analysis of small intestine tissue by CCL8 antibody (K52037_11B4). IHC-P was performed using sections of the formalin-fixed paraffin-embedded small intestine tissue.


PRODUCT

  • SKU

    WZA2200-100ul

  • Size

    100uL

  • Price

    $540

1