Mouse anti-Human CXCL8 Monoclonal Antibody (Clone K06289_9F3)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA1149-100ul

  • Size

    100uL

  • Price

    $795

1
This antibody was raised against a protein with Unprot Accession # P10145. It's core sequence is: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
target CXCL8
host Mouse
gene id 3576
reactivity Human
clonality Monoclonal
clone number K06289_9F3
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:250-1:500, WB 1:1000, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with KT215 at 3.0 ug/mL as the capture antibody. CXCL8 (Cat. PP-530) was used as the antigen. Peroxidase conjugated mouse anti-human CXCL8 monoclonal antibody (K06289_9F3) was used as the detection antibody. Result: K06289_9F3 and KT215 can be used as a matched antibody pair to detect and quantify the concentration of CXCL8 .

Immunohistochemistry: IHC-P analysis of tonsil tissue by CXCL8 antibody (K06289_9F3). IHC-P was performed using sections of the formalin-fixed paraffin-embedded tonsil tissue.

Western Blot: 25 ng of recombinant human CXCL8 was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K06289_9F3 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CXCL8 band was visualized using ECL Substrate. Result: K06289_9F3 can detect recombinant human CXCL8 by Western blotting.


PRODUCT

  • SKU

    WZA1149-100ul

  • Size

    100uL

  • Price

    $795

1