Mouse anti-Human CXCL8 Monoclonal Antibody (Clone KT214)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3938-100ul

  • Size

    100uL

  • Price

    $505

1
This antibody was raised against a protein with Unprot Accession # P10145. It's core sequence is: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
target CXCL8
host Mouse
gene id 3576
reactivity Human
clonality Monoclonal
clone number KT214
iso type IgG1
conjugate Unconjugated
applications WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Cross reactivity test: Microtiter wells were coated with various human cytokines. KT214 was used as primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. Result: KT214 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, IL9, IL10, IL11, IL12, IL13, CSF2, IFNA, IFNG, CCL2, KITLG and TNF.

Western Blot: 25 ng of recombinant human CXCL8 was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. KT214 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CXCL8 band was visualized using ECL Substrate. Result: KT214 can detect human CXCL8 by Western blotting.


PRODUCT

  • SKU

    WZA3938-100ul

  • Size

    100uL

  • Price

    $505

1