Mouse anti-Human CXCL8 Monoclonal Antibody (Clone KT212)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA3946-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P10145. It's core sequence is: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
target CXCL8
host Mouse
gene id 3576
reactivity Human
clonality Monoclonal
clone number KT212
iso type IgG1
conjugate Unconjugated
applications WB, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution WB 1:1000, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Cross reactivity test: Microtiter wells were coated with various human cytokines. KT212 was used as primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. Result: KT212 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, IL9, IL10, IL11, IL12, IL13, IL17A, CSF2, IFNA, IFNG, CCL2, KITLG and TNF.

ELISA: Microtiter wells were coated with KT212 at 3.0 ug/mL as the capture antibody. CXCL8 (Cat. PP-530) was used as the antigen. Peroxidase conjugated mouse anti-human CXCL8 monoclonal antibody (KT213) was used as the detection antibody. Result: KT212 and KT213 can be used as a matched antibody pair to detect and quantify the concentration of CXCL8 .

Western Blot: 25 ng of recombinant human CXCL8 run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. KT212 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CXCL8 band was visualized using ECL Substrate. Result: KT212 can detect recombinant human CXCL8 by Western blotting.


PRODUCT

  • SKU

    WZA3946-100ul

  • Size

    100uL

  • Price

    $650

1