Mouse anti-Human CD81 Monoclonal Antibody (Clone K70020_12D6)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4289-100ul

  • Size

    100uL

  • Price

    $720

1
This antibody was raised against a protein with Unprot Accession # P60033. It's core sequence is: KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDC
target CD81
host Mouse
gene id 975
reactivity Human
clonality Monoclonal
clone number K70020_12D6
iso type IgG2b
conjugate Unconjugated
applications IHC, ICC, IP, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:200, IP 1:100, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K70020_1D4 at 3.0 ug/mL as the capture antibody. CD81 (Cat. PQ-088) was used as the antigen. Peroxidase conjugated mouse anti-human CD81 monoclonal antibody (K70020_12D6) was used as the detection antibody. Result: K70020_12D6 and K70020_1D4 can be used as a matched antibody pair to detect and quantify the concentration of CD81 .

Immunohistochemistry: IHC-P analysis of tonsil tissue by CD81 antibody (K70020_12D6). IHC-P was performed using sections of the formalin-fixed paraffin-embedded tonsil tissue.

Immunoprecipitation: Immunoprecipitation was performed by incubation of 2.5 ug K70020_12D6 with SK-MEL- 28 lysate containing 200 ug total protein. After absorption with Protein G beads, the mixture was run on 6-18% SDS-PAGE and blotted onto nitrocellulose membrane. Anti- CD81 (K70020_22A5) at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG (Fc specific) was used as the secondary antibody. The isotype control antibody was KT82. Lane 1: CD81 immunoprecipitated from SK-MEL-28 lysate by K70020_12D6 Lane 2: The same as Lane 2 but KT82 was used as IgG isotype control antibody Result: K70020_12D6 can immunoprecipitate CD81.


PRODUCT

  • SKU

    WZA4289-100ul

  • Size

    100uL

  • Price

    $720

1