Mouse anti-Human CD81 Monoclonal Antibody (Clone K70020_12A1)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4310-100ul

  • Size

    100uL

  • Price

    $720

1
This antibody was raised against a protein with Unprot Accession # P60033. It's core sequence is: KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDC
target CD81
host Mouse
gene id 975
reactivity Human
clonality Monoclonal
clone number K70020_12A1
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, ELISA
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:250-1:500, ELISA 1:250-1:500
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

ELISA: Microtiter wells were coated with K70020_12A1 at 3 ug/mL as the capture antibody. CD81 was used as the antigen. Peroxidase conjugated mouse anti-human CD81 monoclonal antibody (K70020_12D6) was used as the detection antibody. Result: K70020_12A1 and K70020_12D6 can be used as a matched antibody pair to detect and quantify the concentration of CD81.

Immunohistochemistry: IHC-P analysis of tonsil tissue by CD81 antibody (K70020_12A1). IHC-P was performed using sections of the formalin-fixed paraffin-embedded tonsil tissue.


PRODUCT

  • SKU

    WZA4310-100ul

  • Size

    100uL

  • Price

    $720

1